LOCUS       AF153447     2099 bp    DNA                       22-MAY-1999

DEFINITION  Ovine adenovirus 3 hexon gene, partial cds; protease gene, complete

            cds; and DNA-binding protein gene, partial cds.

ACCESSION   AF153447

KEYWORDS    .

SOURCE      Ovine adenovirus 3.

  ORGANISM  Ovine adenovirus A

            Viruses; dsDNS viruses; no RNA stage; Adenoviridae; Mastadenovirus;

            Ovine adenovirus A.

REFERENCE   1  (bases 1 to 2099)

  AUTHORS   Barbezange,C., Benko,M., Dan,A. and Harrach,B.

  TITLE     DNA sequencing and phylogenetic analysis of the protease gene of

            Ovine adenovirus 3 suggest that adenoviruses of sheep belong to two

            different genera

  JOURNAL   Unpublished

REFERENCE   2  (bases 1 to 2099)

  AUTHORS   Harrach,B.

  TITLE     Direct Submission

  JOURNAL   Submitted (22-MAY-1999) Veterinary Medical Research Institute,

            Hungarian Academy of Sciences, Hungaria krt. 21., Budapest H-1143,

            Hungary

FEATURES             Location/Qualifiers

     source          1..2099

                     /organism="Ovine adenovirus A"

                     /strain="PX611"

                     /serotype="3"

                     /specific_host="Ovis aries"

                     /lab_host="primery lamb kidney cells"

                     /plasmid="HindIII-D"

     precursor_RNA   <1..1053

                     /note="for both hexon and protease mRNAs"

                     /citation=[1]

                     /evidence=not_experimental

     CDS             <1..428

                     /note="major capsid protein"

                     /citation=[1]

                     /codon_start=3

                     /evidence=not_experimental

                     /product="hexon"

                     /translation="AYQEVTISNQHNNSGFTAFANASLPREGHPYPANWPYPLIGENV

                     APCTTQKKFLCDKTLWRIPFSSNFMSMGSLTDLGQNLLYANAAHALDMTFEVDAMDEP

                     TLLYVLFEVFDVVRVHQPHRGVIETVYLRTPFSAGNATT"

     CDS             437..1054

                     /note="endoprotease; 23K protein; function=proteolysis

                     during virus maturation"

                     /citation=[1]

                     /codon_start=1

                     /evidence=not_experimental

                     /product="protease"

                     /translation="MGSMEEELRAIVRDLGISPYFLGTFDKRFPGFLHRDKLSCAIVN

                     TAARETGGAHWLALAWFPNAKNFYFFDPFGFSDHKLKQIYQFEYEGLLRRSALAGDGC

                     VNLVKSTETVQGPNSAACGLFCCMFLHAFVNWPDRPMSRNPTMDLLTGVPNADMMKPS

                     SLAILRENQNQLYKFLSSHSPYFRAHRPQIERDTSFNKLLELKNQ"

     polyA_signal    1025..1030

                     /note="for the mRNAs of hexon and protease; one of two

                     possible sites"

                     /citation=[1]

                     /evidence=not_experimental

     misc_feature    complement(1025..1030)

                     /note="Le Moullec site [(T)n(A)p(T)q; n, p, q>=1],

                     described to follow the poly(A) sites in the adenoviruses

                     (Le Moullec et al., 1983); for the mRNA of DNA-binding

                     protein"

                     /citation=[1]

                     /note="unclassified site"

                     /evidence=not_experimental

     polyA_site      complement(1048)

                     /note="for the mRNA of DNA-binding protein"

                     /citation=[1]

                     /evidence=not_experimental

     mRNA            complement(1048..>2099)

                     /citation=[1]

                     /product="DNA-binding protein"

                     /evidence=not_experimental

     polyA_signal    1050..1055

                     /note="for the mRNAs of hexon and protease; one of two

                     possible sites"

                     /citation=[1]

                     /evidence=not_experimental

     polyA_site      1053

                     /note="for the mRNAs of hexon and protease (if the

                     putative poly(A) signal at nt 1025-1030 is the correct

                     one)"

                     /citation=[1]

                     /evidence=not_experimental

     misc_feature    1062..1067

                     /note="Possible Le Moullec site if the hexon/protease

                     poly(A) site is at 1053"

                     /citation=[1]

                     /note="unclassified site"

                     /evidence=not_experimental

     polyA_signal    complement(1062..1067)

                     /note="for the mRNA of DNA-binding protein"

                     /citation=[1]

                     /evidence=not_experimental

     polyA_site      1069

                     /note="for the mRNAs of hexon and protease (if the

                     putative poly(A) signal at nt 1050-1055 is the correct

                     one)"

                     /citation=[1]

                     /evidence=not_experimental

     misc_feature    1085..1091

                     /note="Possible Le Moullec site if the hexon/protease

                     poly(A) site is at 1069"

                     /citation=[1]

                     /note="unclassified site"

                     /evidence=not_experimental

     CDS             complement(1094..>2099)

                     /note="function=single stranded DNA binding"

                     /codon_start=2

                     /product="DNA-binding protein"

                     /translation="SFLVPLKVDIKDLTLLPDAGTMECFRKGVQSWLNEQKRFVPLTF

                     STQKSLQTVVARFVFDFVLRAAEICPSDWNPNGCVVWEHKTNEEKLYCLHGLPMINKE

                     QIVEMDINSENGQRALKESPERAKIVTNKWGRSVVQMKNADAMCCFYDLKSSLNSFSS

                     ESCGYFYSDGNKARQGFYQIRDFVKAMYPQMPKAGEMLLMPLVCECNYGHHVIPLLGK

                     QTCKVTPFALNAVSNIDRSLVEDAKVLATLNNPVVLVFQCCNPVFRNTKANPQKNCDF

                     KISSTDVVMALQLAKQMWSSLTGTKASIVVQEFKWQPQYRVQNTLLPTGQDDADECLF

                     "

BASE COUNT      552 a    492 c    466 g    589 t

ORIGIN

        1 aagcttatca ggaagttact atttcaaacc agcacaataa ttcaggattt acagcttttg

       61 ctaatgcgtc tttacctaga gaaggccacc cttacccagc taattggcct tatccgctca

      121 ttggagaaaa cgtggccccg tgtaccaccc agaaaaagtt tttgtgtgac aagactctgt

      181 ggcgcatccc attctctagc aattttatgt caatgggctc gctcactgac ttggggcaaa

      241 acttgttgta cgctaacgcc gctcatgcgc tagacatgac ttttgaagtg gatgctatgg

      301 atgaacctac attgctgtat gtgctgtttg aggtatttga tgttgtgcgc gtgcatcaac

      361 cacacagggg cgtcattgaa accgtgtacc tgagaactcc gttctctgct ggcaacgcca

      421 ctacataatc gccgcgatgg gctccatgga agaagagttg cgagctattg ttcgcgactt

      481 aggcataagt ccttactttt taggaacttt tgacaagcgc ttcccaggtt tcttgcatag

      541 agataaactg agttgcgcga ttgtgaatac agcggcccgc gagaccggtg gggcccactg

      601 gctggcgcta gcttggtttc caaatgctaa aaacttttac ttttttgacc catttgggtt

      661 ttctgaccat aaacttaaac agatttatca gtttgaatat gaaggcttgt tgcgccgaag

      721 cgcgctagcg ggcgatggct gtgtaaattt agtgaaaagc actgaaacag ttcaagggcc

      781 aaacagcgcc gcctgtgggt tgttttgttg catgtttttg cacgcttttg taaattggcc

      841 agaccgccca atgagccgca accccacaat ggatttgcta actggggtac ctaatgctga

      901 tatgatgaaa ccgtcgtcgc ttgcgatttt aagagaaaac caaaatcagc tgtataaatt

      961 tttgtcatcc cactccccat actttcgcgc tcaccgcccc cagattgaac gcgatacctc

     1021 ttttaataaa ctgctagaac tcaaaaatca ataaactgaa ctttattgaa cttttgcgtg

     1081 tcagtatttt gctttaaaaa agacattcgt cggcatcatc ttggccggtg gggaggagag

     1141 tattttggac tctgtactga ggttgccact tgaactcttg aaccacaatg gaagccttag

     1201 tgccagtgag cgaagaccac atttgcttag ccagctgcag agccatcaca acatcagttg

     1261 agcttatttt aaaatcacaa tttttctgag gattcgcttt agtgttgcgg aacactgggt

     1321 tgcagcactg gaacacgaga accacagggt tgtttaaagt ggccagcacc ttagcatctt

     1381 ccactaaaga acggtcgatg ttgctgacgg cattcaaagc aaaaggggta actttgcaag

     1441 tttgcttgcc aagaagagga ataacgtggt ggccgtagtt gcattcacac accaacggca

     1501 tcaacagcat ctcgccagcc ttgggcatct gcggatacat ggcttttaca aaatctctaa

     1561 tttggtaaaa gccttgacgg gctttgttcc cgtcagaata aaagtatccg caagattcag

     1621 agctaaaaga atttaaagaa gattttagat cgtagaagca gcacatggca tcagcattct

     1681 tcatctgcac cacactgcgg ccccacttgt tggtgacaat tttagccctc tctggcgact

     1741 cttttagagc gcgttgaccg ttctcgctgt ttatatccat ctccacaatt tgctccttgt

     1801 taatcatagg cagcccgtgc agacagtaga gcttttcttc atttgtttta tgttcccaca

     1861 cgacgcaccc gttagggttc caatcagaag ggcaaatttc agccgctctt agcacaaaat

     1921 caaaaacaaa tctagccacc acagtctgta aagacttttg tgttgaaaaa gtaagcggca

     1981 caaatctctt ctgctcgttg agccagcttt ggacgccttt tctgaagcac tccatagtgc

     2041 ctgcgtctgg aagcagcgta agatctttta tatccacttt taatggcact aaaaagctt

//